scottobear: (Default)

0512091132.jpg, originally uploaded by scottobear.

found graffiti in annapolis

scottobear: (Default)
I officially know more about Rsync than I ever thought I would. It's a mighty handy tool.

Long story short -
rsync is written as a replacement for rcp and scp. One of the earliest applications of rsync was to implement mirroring or backup for multiple Unix clients onto a central Unix server using rsync/ssh and standard Unix accounts. With a scheduling utility such as cron, one can even schedule automated encrypted rsync-based mirroring between multiple host computers and a central server.

Currently doing a master <-> master -> offisite slave config.

Also set up a sql-based login system for both the primary and backup servers for ftp - annoying, as the backup's mysql config is just different enough to give a man fits. in the data directory rather than usr.



Beefy mac & cheese (made with veggie-meat, of course) with the remains of the rattatouile and green beans made for good eats while BHK and I watched the Kevin Sorbo episode of Middleman. The show keeps getting better and more entertianing... I wonder how long it'll last? I hope it'll keep steam going for another season.

I want to start watching Dexter - BHK is about a season ahead of me. Time to put episodes on the PSP for the commute to work.


via BHK -

COOL! Reverse graffiti - where the graffiti is created by placing a stencil over a dirty patch and cleaning it to create a pattern! I like it!!!!
tons of it on FLICKR too!



1 year ago - amazon groceries, Crecy, potatoes from the garden, Rove out

2 years ago - pics from britta's birthday and walkabout, ocean movies

3 years ago - strawberry shortcake, silas stingy, bus ride video, video watching, about me meme, errors at work

4 years ago - np tech fizzed out, disney rides, bro gets 2 years probation, CoH, hurricane Charley, RvsB-internet, Horny Toad

5 years ago - Gelatinous Cube, Chimera / Mosaics, Schwarzenegger, I work with fools blog, David Carlson, wonder woman, cockroaches/dominoes, AAA vs speed traps, director, google calc, teen titans theme cracked

6 years ago - cheaters, fartlek, Gamera, Nation of Victims, Nimoy sings about Bilbo

7 years ago - random journal reading, suasion, hobson, pancake bunny, misc news, super powers/poll

8 years ago - went for sleep study Geotarget
scottobear: (Default)

About 45 minutes ago, work called and woke me up - the two machines in accounting are not talking to each other for some reason - some sort of sharing issue.

If they can't get it to work, I may have to take the 90-minute commute all the way down there to spend two minutes reestablishing a network connection. That'd be quite annoying. We'll see if I can walk them through it.

[edit - Ah, thank goodness. 10:49am, and I didn't have to cruise all the way down there. back on track]



Some walkabout pictures from yesterday - Hover over the thumbnail for a title, or click to make with the bigger.

The 3-d movie yesterday was fun, as was the trip to the museum of art. Tina was nice company, too. I could eat another couple of those 3-cheese empenadas.

Last night was a delight, cooing into the wee hours of the morning with Allison until I was drifting into snoozetown. Pleasant, happy dreams followed.

sadlittleghoststicker-graffitihyperinactivebird-flugraffiti-skull-yumstickergraffiti7stickergraffiti6graffiti-munsterstickergraffiti5stickergraffiti4stickergraffiti3stickergraffiti2scriblez-graffitihellhoundsgraffitistickergraffitigraffiti-tilegiraffe-graffitichina-white
Ghosts, bird flu, more giraffes, hellhounds, skulls, many stickers

sk8boy1sk8boy2sk8boy3sk8boygalsk8gal2sk8gal1sk8gal3sk8gal4
Skaters at the Broward County Library. I have quite a few of these.. could make an animated icon, perhaps.

geocache-fount1geocache-fount2railroad-southrailroad-northgeocaching-bryanpoint
fountain geocache, RR tracks, Wrecked GPS marker by imax




Well, now that I'm officially free, I think I'll take myself out to breakfast, and work my way to Sugar Sand Park. Have a happy one, dear journal!

Bonus - I can get to Sugar Sand via one bus from Hillsboro & Fed - 92 westbound to loggers run, once an hour at 20 past. (I'll make it to the 12:20, no problem, but 11:20 may be over-optimistic)



And now, the archives -

1 year ago - goth girl, walken '08, dane cook re: superman shirts, silly tiger, scotto is, strikeout meme, newt pic at my old apt,

2 years ago - palm doodle, storm disastrous, necco wafers, hurricane journal-guy

3 years ago - wwcalc, Mexican casserole, newt sniffing, sewer travels, blackouts

4 years ago - cool comics, broken links, memories from 1981, hump-day

5 years ago - good feelings, abusive employee/employer relations, wonder tomato condiment poll, evil news, taught chmod

6 years ago - sleep study follow-up, peaceGeotarget

scottobear: (Default)


giraffe graffiti
Giraffe graffiti on a traffic post near my old apartment - taken en route home yesterday. Aw. Giraffes!



Danny talked to Doug Wu yesterday... they're playing telephone tag right now, but it'll be interesting to hear what new in Dougsville. Dan's also officially back to school now. The kids start next Monday, but he's got meetings and classroom setup to perform this week.



Gabbed a bit with [livejournal.com profile] graypumpkin - It was good to chit-chat a bit. He pointed out to me that Giganta is actually more than just a hot, evil, size-changing redhead.

She's a a hot, evil, size-changing redhead that used to be a Gorilla. How awesome is that, really? Forget Lesbian Batwoman... give me a foxy ex-ape in a leopard-ish bikini.

giganta gorilla
Yeah, baby.. that's right.



Green WiFi is committed to providing solar powered access to global information and educational resources for developing nation K-12 school children striving for knowledge in a digitally divided world. There are approximately 3 billion people under the age of 15 living in developing nations. 42 percent of the developing world's population is below the age of 15. Green WiFi was founded on the principle that the welfare of our world is dependent, in large part, on providing these children with free and open access to the world's information.



Bob Ross Feeds a Squirrel



moment of lyric - windows media file

... )

Good morning starshine
The earth says hello
You twinkle above us
We twinkle below

Good morning starshine
You lead us along
My love and me as we sing
Our early morning singing song

Gliddy glub gloopy
Nibby nabby noopy
La la la lo lo
Sabba sibby sabba
Nooby abba nabba
Le le lo lo
Tooby ooby walla
Nooby abba naba
Early morning singing song

... )




1 year ago - Lesbian movie scenes, student aid, the goon & pie, lisas go to TX, Harry Potter, everything can change, wirehog

2 years ago - Bro's sentencing, EN makes a good impression (other guy fizzed out), Daredevil question, Koko wants a dentist, Tropical Storm

3 years ago - muttonhead, rain, flash, dan at school, voodoo 4, lychee yum, walking stick self defense, ati multi monitor life, noisy neighbors

4 years ago - spiders on drugs, Uzumaki, me and newt's custom HC dials, goodies for Kev's sis, bear teeth, a moment of Zen

5 years ago - utility kilt, uncle bill, intrepid

6 years ago - first online radio(broken), food out with Danny, made the "decaf espresso=kissing your sister" joke, Hollow manGeotarget

scottobear: (Monday!)

I've got some good thoughts to buoy me through Monday Meeting!

Every day is a new challenge, but I've got some good ammo to combat most challenges that come my way lately.



Danny sent me the complete first season of the Lynda Carter Wonder Woman series! (The Pilot Movie, and 13 regular episodes). Very Keen. Apparently Paradise Island is in the Bermuda Triangle, according to the show...I always pictured it in Greece.



Had a nice walkabout yesterday... went to riverfront to check out the place before it gets torn down to make way for condos. Took a few snaps, met up with Tina. We had a little bite to eat at the Italian place, then saw Monster House. I quite enjoyed it, though it was a bit slow at first... and I wasn't expecting a PG rated thing in that style. Some pretty unexpected turns, and character actions that were rather creepier than an evil house that eats people.

Post movie, we chitty-chatted and got ice cream before it was time to go - getting spoiled.. I just had a cone with Danny last Thursday.

Still haven't seen Pirates (Movie-time conflict), and putt-putt is being saved for a day when we can get a bigger crew together.



Pictures of construction, graffiti, and etc. )



Moment of Lyric - vox

... )

Punk rock girl
You look so wild
Punk rock girl
Let's have a child
We'll name her Minnie Pearl
Just you and me
Eat fudge banana swirl
Just you and me
We'll travel round the world
Just you and me
Punk rock girl



1 year ago - what's in my fridge, cosmic treadmill, 37 inches of rain, falling people, sky high powers,

2 years ago - went out w/Dan to ole ole, riverwalk pics, SAD Dave, Daimajin added towish list (and it was gifted to me before the hurricanes came!), star wars kid gets an ipod

3 years ago - Web design, poo, web stat, psa, orange newt-head!

4 years ago - broken links, spamdemic map, floppy poll, dinner sick, new semagic client

5 years ago - hinterland, kickshaw, I like cooking, planet of ??? poll, Champions Spectre, my gal wants to leave me for the Asian prince, shaking hands,treat pack

6 years ago - idiot, the good and bad of the day, Good Chinese food, bad AprilGeotarget

scottobear: (Thingie! You big dumb freak!)

Going to play Pirates with Danny after work today, if all goes well. My Sea monster, Spanish Fort and Ships vs his Brits and Pirates. Yarr!



yet another quiz/meme - this time via [livejournal.com profile] fivefootmayhem

Pirate quiz )

Well, that's sort of harsh!



61 questions )



Piccies from Yesterday - 2 self-portraits and 2 misc. Funny that I caught myself at the stop... I thought I was leaning out of frame, not just at the edge.

still life with banana and hair extensions
still life with banana, cigarette butts and hair extensions

selfport-bus stop
Self Portrait at 5:10am, Sleepy. Bus stop.

2 more )




1 year ago - bro visit, good exp games, Karl Rove a rat, mood settings, big ol' Locust

2 years ago - perspective via work, kitty-bot, rain, diseases

3 years ago - Movies w/ danny, LED-suit, Lupin quiz, dinosaur haiku, new tv, LXG, html tests, ghoulishness

4 years ago - Ian McCracken, zork 404, branleur, got my bike

5 years ago - evil news, longueur, spoliation, space fungus, superstition poll, fri-13 reasoning, I'm Neutral Good

6 years ago - Traditional trolls, Catholics handy in a pinchGeotarget

scottobear: (Default)

Moment of Lyric - via He's a Whore

... )



Don't try tell me that you're not aware
Of what you're doing and that you don't care
You say that it's easy, just a natural thing
Like playing music that you've never seen

Ooh-hoo, Jackie Blue
Making wishes that never come true
Going places where you've never been
Ooh, Jackie, you've blown it again

... )




Random Key West Vacation Things:

[livejournal.com profile] weezeroni and [livejournal.com profile] mental_circles share similar accents and voice cadence.

At tri-rail - realized that I'd shave over 2 1/2 hours travel if i take the train from Miami to Deerfield. Greyhound driver from key west to Miami was excellent, professional, helpful, polite and very competent driver. Robert Rios will be getting a letter of praise sent to his office.

The vertigo tunnel at Ripley's is worth the price of admission.

I missed seeing tiny deer. - (see also - wikipedia) I look forward to spotting a few next time.

I couldn't get Ripley's-specific postcards for Pye, but I think he and his mommy'll like the ones I sent.

I saw maybe three dozen derelict boats between Marathon an Key West... and I think that's pretty keen.



From the Tri-Rail Miami Airport Station on to Deerfield. Primarily Railroads, Graffiti, and Urban Decay.

Feel free to view them as a slideshow.

thumbnails )



1 year ago - Magda time, ff flick reviews in, supernatural crime, free slurpees, angels with attitude *shudder*, Wilde on the red rose, insanity, bottles on string, math symbol uses, had to htaccess, pagenation, melissa gilbert, 911 google, florida mafia

2 years ago - Newt says Mao, travel pondering, manatee, Dan alters color scheme, good eats

3 years ago - Zwan, I snuff griefer #5, movies, elvis tooth, bad baby names, net radio, flipped off by the universe

4 years ago - reflecting on old work, log issues, Newt attack, recalling palm animations

5 years ago - fetial, solecism, pockets poll, purse poll, evil news, pie poll, tuck-ins

6 years ago - words, bro moving to townGeotarget

scottobear: (1 - travels - where the road leads)

Woke up on Saturday with a slight pinch in my back... must've slept a little funny the night prior... a hot shower and some stretching took care of the bulk of the problem in fairly short order.

Had a lovely day meandering about, looking for proper goodies to put in the apartment, sniffing at teak and rattan-type stuff. Saw a few things that had some potential, and a truly grotesque table that was also a drum made from zebra skin (and legs made from the hooves) which will give the more sensitive folk nightmares for weeks.

As always, we got a lot of good gab-time in, and I always enjoy a day's worth of social-time.

After doing some legwork, we swung by Tijuana Taxi, and the food was jim-dandy. The place was basically a Mexican version of Crabby Jack's - with better food. I'll certainly be back. (I've got 2 additional good reasons to swing by there, it's near both Danny's house and Tina's.) Since the refried beans were made with lard, I had the chile-cheese smashed potatoes, and they were tasty, though it took a moment to get used to the idea of mashed potatoes with a south of the border flair. I think I'll have to get something a little lighter next time, because the veggie Chimichanga was just too much after an appetizer.

When we finished, I took the BCT home... route 2 to the West Terminal, Route 22 to Central, and Route 10 right on home. I ate so much, I was *still* feeling a bit overfed 2 hours later.

The bus ride was nice, too... the rain started to pound down, coming in sheets to the point where I couldn't see more than 25 feet in any direction. Thankfully, the terminals are well covered against the elements. (most street stops aren't so blessed.) By the time I got home, the streets were clean, but the skies had fairly dried up, for the final walking-leg home.

walkabout pics - found objects and stencil graffiti

hairbrush, beer and onions?mask
Hairbrush, beer and onions & Mask over archives

stairwellYou're loved
Stairwell to Tattoo place & "Relax, You're Loved" at Chiropractor's window

optimus prime - near minimalistar2d2
Stencil Graffiti - Optimus Prime and R2-D2

herman munsterprofile
Stencil Graffiti - Herman Munster and Face in profile

detail - keepin mullets evilgraffiti
TNT- Keepin Mullets Evil. (I'm sure that's really hard work)

pencilsketch
unpainted life-size pencil sketch of some skate-kid.




Current Music - Instrumental - Mp3



Because of the rotation of the earth, an object can be thrown farther if it is thrown west.



1 year ago - weary, Alex Toth's last birthday, journal entry length, stumbleupon, silver bullets, bso pics, data munging, dork, smashing pumpkins, dalek mood theme, call forwarding, testing flickr's autopost, newtcam pic!

2 years ago - Ubermensch Baby, walk the drunk, hulk returns to blogville, talked with sedef, tiki beach doodle

3 years ago - sernya, Zod is Jor-El, plushie supers

4 years ago - random adds, new place, sleeping late with cat, riaa shaman defeats bad magic box, Francesco skips out, no cable.

5 years ago - oblation, wonderful world, chopping block

6 years ago - threadsGeotarget

scottobear: (Default)

Watched Iron Giant last night, for the first time in a few years. Still as excellent as I recalled. While it played on the TV, I unpacked a few of the boxes stowed by the bookcases that needed weeding out. Found a bunch of old Legion Comics which distracted me for a bit while I put 'em in order and put them at the bottom of the linen closet, for the lack of a better temperature-controlled location. Followed up with The Swarm. (An Irwin Allen Sci-fi stinko classic featuring Michael Caine shooting bees from his eyes.)



Cleaning Lady comes by today... after she's done, I'll probably go walkabout for a bit, if the weather's right. I think a walk along the beach might be in order.



Cinnamon toast for breakfast! First time I've made it in years... it always reminds me of being a little kid.



Best Message board icon of the moment - 2 cats playing ping pong.





Some pics from yesterday -

sticker graffiti- cookie monster
Cookie Monster Sticker Graffiti - Just kidding? On the rear exit of the Route 10.

sunrise pano 060206
Bus stop - sunrise was like a fire boiling away clouds.. rain was happening a bit to the right.



Found a number of OTR podcasts... about 8-10 hours of classic stuff every week. Songbird is pretty handy there. Sort of disappointed in Penn Gilette's show, so I'm almost all NPR, OTR, and Prairie Home Companion... oh, Stomp Tokyo and Marc Maron's show. Sometimes I listen to them on the ride into/from work, while reading, and I sometimes blank out what I'm listening to.



Moment of mp3 - Cake - The Distance - It reminds me of the 90s.



1 year ago - Celine Dion as MJ, Tragic Darth, Boynton Tasering, great sunset, Firpo, MSK in NM w/UTI, look-around camera, sex-pred lj, chat w/sammy, tyrant in the house?, human trafficking, 20 questions meme

2 years ago - Dan visit and a caveman waitress, speaker scam, call me Q.

3 years ago - isketch, skeletor & gang, Scott-heroes, Wold Newton, I LIKE stuff, ugly Oz from MacFarlane toys

4 years ago - virus spam, moment of zen, gute fahrt, pet psychic, Crossing over guy,newtcam banner (Never did see it in rotation.), homepage design ideas

5 years ago - |337 translation guide, parse, fun turtle fact, ultrasonic cheesecharacteristics, Hello Kitty Douche, lj portal, long distance distress

6 years ago - nothin'Geotarget

scottobear: (Default)

no bills jesus
Originally uploaded by scottobear.

Hooray for fast-apply sticker graffiti!

jesus2

Nov. 2nd, 2005 09:35 pm
scottobear: (Default)

jesus2
Originally uploaded by scottobear.

why does he keep looking to the right?

scottobear: (Default)

sofla-stickers-2
Originally uploaded by scottobear.

sticker art found around sofla

scottobear: (Mer!)

Shy street penguin
Originally uploaded by alexandra666.

Awww... Cute Graffiti! :D

scottobear: (1 - sketch (stories and coloring))
Looks like there's a new guy on the scene "Emnity". Toro, Blackie, and Dose have all been in the area for a while.

dose1005
Dose is still kickin'

toroandblackie7fq
Messy, but spiffy

stickers3aq
I'd like to have this sticker, to be honest.
scottobear: (museum fart (Dan Travels))



Well, I went for a walk on the gamma testing range, but I didn't bring my Uru walking stick.

pictures from walkabout )





My LiveJournal Trick-or-Treat Haul
scottobear goes trick-or-treating, dressed up as a zombie!.
eryx_uk gives you 7 purple grape-flavoured nuggets.
graypumpkin tricks you! You lose 1 pieces of candy!
juliabee tricks you! You lose 2 pieces of candy!
lilmizscareall gives you 4 red coconut-flavoured gummy worms.
meredith gives you 14 light yellow licorice-flavoured nuggets.
oneeyedcat tricks you! You lose 13 pieces of candy!
sedefendendo tricks you! You get a dead frog.
sida_al_hurra tricks you! You get a scratched CD.
weezeroni gives you 4 red-orange chocolate-flavoured wafers.
wickenden tricks you! You get a rock.
scottobear ends up with 13 pieces of candy, a dead frog, a scratched CD, and a rock.
Go trick-or-treating! Username:
Another fun meme brought to you by rfreebern.




1 year ago - hurricane jeanne, scotto doppler, pookies, miss cleo, Aztec soul

2 years ago - big ear dog, spam fraud, gyromancy, I help cej with programming

3 years ago - mush, work drama, leopard man, pd supers

4 years ago - av, wookie, allergy lj poll, hoboes are hated, cej poopy, philo poll- plato's my guy, lj meme tracker (currently down)

5 years ago - met CEJ, frag speak, jen''s poochie, work lapse

7608 -

Aug. 3rd, 2005 07:07 am
scottobear: (Default)


2nd Batch of allergy shots, and then platelets. I have to see if I can still donate today after the shot.



Dan goes back to school tomorrow or Friday, for kids begin on Monday. I wonder if we'll get to goof of any more before he's back in the grind?



The New Semagic LJ client is a lot friendlier to tags.



Moment of Lyric:

... )

When I'm lonely yes I know I'm gonna be
I'm gonna be the man who's lonely without you
When I'm dreaming yes I know I'm gonna dream
Dream about the time when I'm with you




Flickr explore, interesting photos in the last 24 hours and clustering for tags.



I'm glad that June and July are in the past. Those are usually the two worst months of my year, stretching pretty far back.



Today is Bro's arraignment. I suspect he'll get off with a mild wrist-slapping as long as he keeps his wits about him. That's a tricky proposition at best, though.I suspect that he'll be in for two months at the worst. I told him to bring his junk over to my place for storage, so he doesn't have to go through last time's "vanishing goods" situation.



Local Graffiti Taggers Caught in sting, including Dose & Normel. Read more... )

I can't believe the average age of those guys was 25 years old... some stunted development there. I'd expect that stuff from teenagers, not 20-somethings.



Some Newt pictures to make me happy. Clicking on 'em generally makes 'em bigger if you look at all sizes on flickr.

newt looks yellow
Chillin' in a sunbeam, guarding the Cell phone,
trying to not look like he's been caught batting the clie charger.

eclipso newt
What sinister plan is lurking behind those eyes?

newt eye
Newton giving me the Keith Giffen "big eye" panel.




x-men quiz )



1 year ago - $100 adsense, German offer (which never paid me), politicomix, elitist, piehole, David Keith (never panned out), mortifying flashback.

2 years ago - blogshares, vampire game, hollow earth trip, dead lizard, kinetic sculptures, PSA, whiners / professional victims, pastry sculpture,

3 years ago - went to the singing fountain, sleestaks, telemarketers, Art conspiracy (No Longer allows remote linking! bah!), rainy laundry day, evil ashtrays, Signs, Halloween costume thoughts

4 years ago - Mexican jumping beans, Crayola tech support, germane, evil news, bachelor dinner, warped radio

5 years ago - religion quiz, taco bell binge, Dopey Client desires, red rubber ball

scottobear: (be ready to defend yourself)

Ah, Monday. The weekend was too brief, as always. Bro goes to court this morning. We see if he spends the next year in jail or not.



I spent much of yesterday walking on slight disconnect. It seemed almost like I was a little bit outside of my body, controlling it remotely. Minor numbness, sort of how I picture Boston Brand and his hosts.

Las Olas Alley

Walkabout... Alleyway, 21 w Las Olas Blvd, Fort Lauderdale.
I wander through here pretty much every day after work.


I'm having too much fun fiddling with autostitch. I may make the largest version a wallpaper on one of the computers at work.

All kids love log!

log


I also found a stickerart (graffiti) pool in flickr.



Would people who imprison others called imprisoners? That's a clumsy term.



The New Harry Potter Book (both text and audio book) were available for bittorrent download within 12 hours of its release. I can't search for nice legal public domain books without tripping over the dang thing. A wide assortment of formats, rtf, pdf, txt... you name it.

Also, 827 pages? somehow, I suspect the dire need of an editor still remains.


[livejournal.com profile] waxy_org spotted this thread.



Looks like a zombie variant on the old vampire game. from the same guy that came up with the original plans for the Zombie Infection Simulator (This revision is the best I've seen of the ZIS. A lot more features than the one I put together.)



I'm officially sick of the Bard's Tale. total play time, about 5 hours, give or take, in 1-2 hour bites. some cute moments, but meh. If I could save at any time, and not just at certain way points, I'd have liked it a lot more. Nothing makes me toss a game aside faster than "Whoops, you lost, go back and do the same 20 minute brainless series of combats again". After doing that thrice or so, I'm finished.

Maybe I'll come back to it after I've taken a FarCry break. Maybe not. Depends on what's on my plate. I'm only up for so much whack-a-mole, no matter how cute the in-jokes are.



It's been said that imitation is the sincerest form of flattery. I don't know about that, but I have been seeing a lot of "flattery" lately. Not the basic stuff; passing around links and quizzes is a lot of what is fun, but replicating the format down to "Moment of lyric" and so on is sort of weird. I hope that they find their own voice soon.



Speaking of the Moment of Lyric:

... )

Everyone's a building burning
with no one to put the fire out.
Standing at the window looking out,
waiting for time to burn us down.
Everyone's an ocean drowning
with no one really to show how.
They might get a little better air
if they turned themselves into a cloud.




1 year ago - manatee trip pictures, Miami travel shots

2 years ago - Aol gives up on netscape, random poster form the past, I get fan mail from desert butterfly, reading list retreat,

3 years ago - princess sultanas circle, hug meme, joy machine, angry corn ghosts burn police cars, hydrogen fuel cars, got tested for diabetes (none here!), baseball bat poll, Bush & Women's rights, spooky patent office logo

4 years ago - evil news, arriviste, clochard & myopic, gilligan's lessons, contraception myths, Leisa's 2 months pregnant, zeppelins, tuckin thoughts

5 years ago - xanadu, sleep study prep, name meaning

scottobear: (Newtie blah-blah)

Friday. Small issues being blown totally out of proportion by the big Kahuna. Primarily a side effect of the last day before she heads out of the office for training California. Later this morning, I'm going to have to clarify things to her.

I got to talk to Governor Schwarzenegger's secretary for about 5 minutes yesterday. That's an upside of opening California, I guess.

Flipside, some of the techs have been getting a little lazy on the reports, and that's increasing my paperwork. I'm not going to bark, but I will have to send out some friendly reminders.



Newtcam Piccies and some graffiti

Read more... )

I finally found out what 7S means. "Seven Soliders" - (not Soldiers, Solid-ers)



Autostitch is an *amazing* photo merging program. I'm still trying to figure out how it does it so well. Check out the panoramas!


Benjamin Smith III of St. Petersburg, Florida used to park his SUV outside the home of Richard Dinon for one reason only — to steal his WiFi! Shocked and appalled, Dinon called the police and had Smith arrested for using someone else’s bandwidth.

Florida law enforcement arrested Smith for unauthorized access to a computer network, which counts as a third-degree felony. - via glassdog



Reality Show Premise Generator

Isolation Iceberg
A group of Norwegian lepers stranded on a Melting Ice floe competes for a chance to rejoin civilization.

But the catch is:
Civilization has been destroyed by aliens



National Geographic Pictures of the Year



I'm with J-walk on the whole podcast thing.



Q. Why did the programmer always confuse Christmas and Halloween?
A. Because Oct 31 equals Dec 25.



Google Maps satellite/street map transparency overly.

see also - Google weather map

Or Google maps mania



FlightGear is an open-source, multi-platform flight simulator.



Turn a backpack into a portable, solar-powered Wi-Fi hotspot, and share a high-speed connection anywhere



1 year ago - combos/snausages , wisdom, serving sizes, ramen, Rockford Files, Planetarium pictures, weather, sock thief

2 years ago - call block, snapple, intelligence gathering, Batroc, flashback cartoon, addictive data,

3 years ago - oz/floyd connection, pimps at sea, rss feeds start, cat dreams

4 years ago - sweetheart returns, unpacking videos, 1992 tax info, the challenge, corn chowder, kubrick quiz

5 years ago - Rowlf sings, April actually kicks back a few bucks, pondering a new recorder

scottobear: (museum fart (Dan Travels))

Visited MP for a bit in the morning, and it was certainly the highlight of my day. We had breakfast and hung out a bit, and then she headed to her sister's place in Miami for a BBQ. She's staying in town until the 14th, and then will be in Colombia until Mid-September. I'll miss her quite a bit... thank goodness for email and telephony!

I stayed in Fort Lauderdale to visit with my brother. It took a while... he took the route 50 up, and was out of sorts... fell asleep on the bus, and hopped off in a semi-stupor. He met me at the Movie theater, and I bought us tickets to see Land of the Dead. He Sprung for nachos, and we settled in for some down and dirty zombie-action.

About 30 minutes into the film, he asked me if he was on a bike when we met... I replied no, and he got distressed... turns out he left it on the bus bike rack, and forgot it when he hopped off at 2pm. He stepped into the aisle to call Broward County Transit and report it missing, while I continued to watch the movie.

An hour later, I'm stepping out of the theater, wondering where my brother is. It turns out he was on hold, and fell asleep waiting for someone from lost and found to answer him because it was the 4th holiday.

So, he missed the movie. He didn't seem too upset about it. We walked back to the bus terminal, where we asked f the bike had been turned in yet.... the 5:30 bus was just rolling up, and lucky for him, bro's bike was riding on the front. Happy ending there, anyhow.

Oh, I nearly forgot, between the theater and the terminal, two homeless guys walking together tried to shake us down for a handout. Bro said "sorry, I've got nothing..." and one of the bums gave him a dirty look and said "bullshit". There was almost a fight, but avoided it because nobody wanted to get the police involved. I held bro back, and BS's friend restrained him. I thought for sure that I was either going to have to take some swings in myself.

Random Scotto factoid: I used carry a straight razor for self-defense. I don't now. I'm more worried about AIDS than I am of an attacker's fists. I've thought about walking with a cane again, in order to have some sort of club handy, but I'd rather have two hands free during my walks... same reason I'm not crazy about umbrellas. I fear carrying a gun.

Land of the Dead was good... and I actually sympathized a little for the zombies. A few pointless scenes, but I rather liked the Cameo by Simon Pegg, too. I especially liked Zombie Clown and Zombie Moses.



Evil Dead: Regeneration - looks good.



A 2,600-year-old corpse has been discovered in the moors of northern Germany. It's not the only one. Such finds are frequent, but have posed an increasingly large riddle: Why were so many of the bodies victims of violence and dismemberment?

Were ancient Germans fiendish torturers, or did these anthropologists watch too many horror flicks?



Lil bit is too much of a cutie! I need Insulin!



Pictures from yesterday's walkies, Post-MP, pre-Bro ... clicking sends to larger sizes.

These are the things in my neighborhood... want to see? )

If you'd like to visit them yourself, feel free... geoblogger map locations



UJIKO search engine... pretty cute interface.

Basic principle: each time you visit a new site, you are gaining one point of expertise. With every 10 points, you move to the next level. Your search engine is mutating, new buttons appear giving you access to advanced features.




The journal of the man who has been arrested for allegedly having something to do with taking that Idaho brother and sister (they disappeared 3 days after his last journal entry.
- thanks for the update, jb! (see also, his removed website, saved at archive.org) Read more... )

He went to prison for sexually assaulting a 14-year old boy at gun point...got out and was then charged with sexually assaulting another child in Minnesota. Now, the Idaho brother & sister issue.

from his 8/24/04 entry - "I am now 99.99 percent sure I will move to a different state as soon as I graduate and can find a job in a state where I'm not required to register. "



Moment of Lyric:

... )

Time is flying like an arrow
And the clock hands go so fast they make the wind blow
And it makes the pages of the calender go flying out the window one by one
Til a hundred years are on the front lawn
And the old familiar things are mostly all gone
But the old sombrero just keep hovering on
Hovering sombrero hover on

Don't be burdened by regrets
Or make your failures an obsession
Or become embittered or possessed
By ruined hopes remember

... )




Question & Answer time )



1 year ago - more Vizcaya pics, vandal of Venice, veggie benefits, Lego Spidey, Estonian wife-carrying, small-world syndrome

2 years ago - Newt and fireworks, bacta tank, printing plate castle, giant monster games

3 years ago - 8-legged freaks, planting, many pictures that no longer link (curse you picture stage!), Harry potter fake book out, baby laff, octothorpe poll, 7

4 years ago - Growing impatient, beverage poll, evil news, cudgel

5 years ago - horrid stream of thought unformatted entry...I still eat much the same stuff, introspection

Profile

scottobear: (Default)
scott von berg

April 2017

S M T W T F S
       1
2 345678
9 10 11 12 13 14 15
16 1718 19 20 21 22
23 2425 26 2728 29
30      

Syndicate

RSS Atom

Most Popular Tags

Style Credit

Expand Cut Tags

No cut tags
Page generated Jul. 26th, 2025 03:35 pm
Powered by Dreamwidth Studios